PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00016437-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NF-YB
Protein Properties Length: 196aa    MW: 20815.1 Da    PI: 5.9406
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00016437-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.93.9e-5523118297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdrflPian+srimkk+lP+nakiskdaketvqecvsefisf+  eas kcqrekrktingddllwa++tlGfe+yvepl++yl+kyre
  WALNUT_00016437-RA  23 REQDRFLPIANMSRIMKKALPTNAKISKDAKETVQECVSEFISFIIREASVKCQREKRKTINGDDLLWAMTTLGFEEYVEPLEIYLQKYRE 113
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +egek
  WALNUT_00016437-RA 114 MEGEK 118
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.1E-5317129IPR009072Histone-fold
SuperFamilySSF471133.11E-3925127IPR009072Histone-fold
PfamPF008081.3E-252892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.7E-195674No hitNo description
PRINTSPR006155.7E-197593No hitNo description
PRINTSPR006155.7E-1994112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MADLDNELGG HNNNNANNDF SSREQDRFLP IANMSRIMKK ALPTNAKISK DAKETVQECV  60
SEFISFIIRE ASVKCQREKR KTINGDDLLW AMTTLGFEEY VEPLEIYLQK YREMEGEKSS  120
VGRQGEKDGG DGVAACGGGT GGVVSFGTSD NGGFNGVGGF YGGMYGGVMG HHHGHVYGSG  180
GSPHVGIGGS VIGKGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4523113292Transcription factor HapC (Eurofung)
4g92_B3e-4523113292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634760.11e-82PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010644567.11e-82PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233102e-68NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG51e-82D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t013e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-69nuclear factor Y, subunit B3